• H-Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala-OH (Disulfide bond) EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA DNP
  • H-Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala-OH (Disulfide bond) EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA DNP

H-Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala-OH (Disulfide bond) EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA DNP

  • Negotiable Get Latest Price
  • 1 Short Ton / Short Tons
  • 100 Short Ton / Short Tons per Month
Product Details
Type:Other, 化工
Product Description
Dendroaspis Natriuretic Peptide 
Catalog Number106P01
Three Letter CodeH-Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala-OH   (Disulfide bond)
One Letter CodeEVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA 
SynonymsDNP 
Molecular FormulaC₁₈₀H₂₈₂N₅₆O₅₆S₂
Relative Molecular Mass4190.69
CAS Registry Number255721-52-9
SourceSynthetic
Storage Conditions-20 ± 5 °C
Areas of InterestCardiovascular System &   Diseases
DetailsThe 38 amino acid peptide DNP, which has been originally   isolated from the venom of the green mamba snake (Dendroaspis angusticeps),   shares structural homology with the family of natriuretic peptides. DNP   contains a 17 amino acid disulfide ring similar to ANP, BNP, and CNP, which   mediate biological actions through particulate guanylyl cyclase receptors and   generation of guanosine monophosphate (cGMP). 

Shanghai Hanhong Scientific Co.,Ltd.

We Provide

peptide , custom peptide , catalog peptide

Main Markets

North America , South America , Eastern Europe , Southeast Asia , Africa , Oceania , Mid East , Eastern Asia , Western Europe , Central America , Northern Europe , Southern Europe , South Asia , Domes

Contact Now

Sourcing Request

Submit